PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70379.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family TALE
Protein Properties Length: 332aa    MW: 37413 Da    PI: 7.1702
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70379.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.5e-092693071854
                 HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  EPS70379.1 269 MFQNflHPYPKDAEKHLLAIKSGLTRSQVSNWFINARVR 307
                 5887779******************************88 PP

2BELL70.62.9e-23134202372
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 ++ ++kk +Ll ll++Vd++Y+q+ ++++tvis+F+av++l++ ++++++A  aiS  + +L+++i+++i
  EPS70379.1 134 RDGEAKKKHLLALLQMVDDQYNQCLDEIHTVISAFHAVTDLDP-NLHARFAIPAISIMYNSLRERISSHI 202
                 67789**************************************.***********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-1769200IPR006563POX domain
PfamPF075268.4E-2274199IPR006563POX domain
PROSITE profilePS5007110.819248311IPR001356Homeobox domain
CDDcd000869.95E-11251312No hitNo description
SMARTSM003897.9E-6251315IPR001356Homeobox domain
SuperFamilySSF466891.71E-15253320IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-26254316IPR009057Homeodomain-like
PfamPF059206.5E-15268307IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
GFSNELLSLS LAANPVVVVA QDHCSEMRSC CSGYSLKMGG SDHNNTSCSS NNNNSSSLSL  60
SSGSYKPIQF PSSVLSGSVF LHTMQEILAE IAGFAVENLD INSFSGDENM LRWTNSSSSH  120
GVPDQNNKFL QQQRDGEAKK KHLLALLQMV DDQYNQCLDE IHTVISAFHA VTDLDPNLHA  180
RFAIPAISIM YNSLRERISS HILAMGTQET EQEAKTKEDN SDNNNGSALE TSFIQKQWAI  240
QQLKKKDHHL WRPQRGLPER SVSVLRAWMF QNFLHPYPKD AEKHLLAIKS GLTRSQVSNW  300
FINARVRLWK PMIEEMCAEM NRRKSRRSDQ DS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-15257315563Homeobox protein Meis2
3k2a_B6e-15257315563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096864.11e-130PREDICTED: homeobox protein ATH1 isoform X1
SwissprotP487312e-96ATH1_ARATH; Homeobox protein ATH1
TrEMBLS8CT000.0S8CT00_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_04s0008g00880.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-93homeobox gene 1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]